PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_016202-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 902aa    MW: 102681 Da    PI: 8.5561
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_016202-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.22.8e-11397442146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT +Ed+ l+ + ++ G ++W+ Ia+++g++Rt+ qc  r+q 
  AHYPO_016202-RA 397 RDNWTSDEDKHLLLLLQKNGIHNWSYIAEKLGTNRTPFQCLVRYQR 442
                      789**************************************99995 PP

2Myb_DNA-binding42.21.8e-13451496248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT++Ed +l  av+ +G  +W ++a+ +  gRt+ qc +rw+k l
  AHYPO_016202-RA 451 RVWTEDEDAQLCSAVEAFGESNWQAVASVFE-GRTGTQCSNRWRKTL 496
                      57*****************************.************975 PP

3Myb_DNA-binding521.7e-16504549248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+t+Ed++l  av+++G ++W++Ia+ ++ gRt  qc++rw ++l
  AHYPO_016202-RA 504 GRWSTDEDKRLRVAVTLFGYKSWHRIAQFVP-GRTQVQCRERWVNVL 549
                      8******************************.***********9975 PP

4Myb_DNA-binding52.79.8e-17556599247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g WT+eEd +l++a+ ++G   W++Ia +++  Rt++qc+ rw k+
  AHYPO_016202-RA 556 GEWTKEEDMKLKEAISEYGYC-WSKIAGCVP-LRTDNQCRRRWKKL 599
                      79*****************99.*********.9**********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.6E-4298393IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-11301318IPR009057Homeodomain-like
PROSITE profilePS500906.435357391IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.4E-11364404IPR009057Homeodomain-like
CDDcd001670.00394367390No hitNo description
SuperFamilySSF466895.74E-18372441IPR009057Homeodomain-like
SMARTSM007171.3E-7396446IPR001005SANT/Myb domain
PROSITE profilePS500909.558396444IPR017877Myb-like domain
PfamPF002491.2E-8397442IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-15405452IPR009057Homeodomain-like
SuperFamilySSF466891.04E-18430496IPR009057Homeodomain-like
PROSITE profilePS5129418.234445500IPR017930Myb domain
SMARTSM007178.1E-13449498IPR001005SANT/Myb domain
PfamPF002491.9E-12451495IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-17453499IPR009057Homeodomain-like
CDDcd001671.36E-10453496No hitNo description
SuperFamilySSF466892.25E-27501596IPR009057Homeodomain-like
PROSITE profilePS5129411.973501549IPR017930Myb domain
SMARTSM007171.3E-12502551IPR001005SANT/Myb domain
PfamPF002492.4E-14504549IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-21504554IPR009057Homeodomain-like
CDDcd001673.12E-11505549No hitNo description
PROSITE profilePS5129424.185550604IPR017930Myb domain
SMARTSM007177.3E-17554602IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-20555599IPR009057Homeodomain-like
PfamPF002493.0E-15556599IPR001005SANT/Myb domain
CDDcd001671.91E-13557600No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 902 aa     Download sequence    Send to blast
MGKYDFVEEL SGSDNDDLLQ EEIQTLSREC FPSNNSDGAS IPATACSVTG GRYLSEDEDD  60
DDDDDDDMEL VRSIKEQYGI EVDISKPLSL KPLISLPPAS SDDDDDDFET LRAIQKRFSQ  120
YGDDKSTDAL ECKNDNCVDK TLHEDVIATS LGSEFVYVHG DDLGENTCDV PQNVETSSCT  180
SNFPKSAQTF VEAIKKNRSC QKFIRNKMLH IEAKMEANRA LQKRLKTLRD FQVQCKKTIG  240
RALSQKQDSR VQLISVPKQK PNIKGSEKNV SAIYYGPLEN SHVALYKTTM KNYPLLFQRE  300
KWSKNEIRAL EKEIIKQFQE RLFQTSADLL SNFDDHGLAN GVDDMISSIT NLDITPEIIQ  360
EFSRKVDWNK LASRLPRRSG VECEARWLNY ENCLINRDNW TSDEDKHLLL LLQKNGIHNW  420
SYIAEKLGTN RTPFQCLVRY QRSLNASIMK RVWTEDEDAQ LCSAVEAFGE SNWQAVASVF  480
EGRTGTQCSN RWRKTLLPAR QRVGRWSTDE DKRLRVAVTL FGYKSWHRIA QFVPGRTQVQ  540
CRERWVNVLD PSLKHGEWTK EEDMKLKEAI SEYGYCWSKI AGCVPLRTDN QCRRRWKKLF  600
PNEVPLLKAA KHIKEVALIS NFVDRESERP ALGMNDFVPL PITNSANETE KEKISRTRKR  660
KGIAPNTQSI SHLKGVASRK RKRNDKSSGD ANNCNDACST DGYGIQENKK FSAIRSDSKK  720
KKHCGNLNTT RKPLKSGKST HSHEGNAEET NCRNMPIKTR SRRPQGNSKK QIGDGIQADL  780
SNMVTVARNK RSSQLQLRSS FAETSFGDDC EQTELRDGNE THSMDTAGSS KEKTVKKKKK  840
RELHADQSLE WEDLPLSILL KKDIAHKERS ISNLTSKPPV KPPIYLTYAR RNRNSNLENS  900
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-273675964155MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-273675964155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674396.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_010674395.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_010674394.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_010674393.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_010674392.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_010674391.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_010674390.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_010674389.10.0PREDICTED: snRNA-activating protein complex subunit 4
TrEMBLA0A0K9R9D00.0A0A0K9R9D0_SPIOL; Uncharacterized protein (Fragment)
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-165myb domain protein 4r1